Native Human IgM Protein (RMPP-00230979)
Cat. No.: RMPP-00230979
Category: Recombinant Protein
Research Area: Tags & Cell Markers
INQUIRY
1mg
Customer Size
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | WB; ELISA; SDS-PAGE |
| Key Features | Expression system: Wheat germ; Suitable for: WB, ELISA, SDS-PAGE |
Protein Information
| UniProt ID | P22083 |
|---|---|
| Molecular Weight | 37 kDa including tags |
| Sequence | ITYACWGQLPPLPWASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFN ISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDL |
| Sequence Similarities | Belongs to the glycosyltransferase 10 family. |
| Protein Length | Protein fragment |
| Cellular Localization | Golgi apparatus > Golgi stack membrane. Membrane-bound form in trans cisternae of Golgi. |
| Function | May catalyze alpha-1,3 glycosidic linkages involved in the expression of Lewis X/SSEA-1 and VIM-2 antigens. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8Constituents: 0.3% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
