Recombinant Human Activin Receptor Type IA (mutated G328E) Protein (Active) (RMPP-00230512)
Cat. No.: RMPP-00230512
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
5 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 97% SDS-PAGE. > 97% by HPLC. |
| Nature | Recombinant |
| Animal Free | No |
| Form | Lyophilized |
| Applications | HPLC; SDS-PAGE; Functional Studies |
| Key Features | Expression system: E.coli; Purity: > 97% SDS-PAGE; Active: Yes; Suitable for: HPLC, SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | P19876 |
|---|---|
| Molecular Weight | 8 kDa |
| Sequence | AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEV CLNPQGPRLQIIIKKILKSGKSS |
| Sequence Similarities | Belongs to the intercrine alpha (chemokine CxC) family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Function | Ligand for CXCR2 (By similarity). Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes. |
| Post-translational Modifications | N-terminal processed form GRO-gamma(5-73) is produced by proteolytic cleavage after secretion from peripheral blood monocytes. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle. pH: 7.40Constituent: 100% PBS This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
