Recombinant Human Activin Receptor Type IIA/ACVR2A Protein (Active) (Biotin) (RMPP-00230502)
Cat. No.: RMPP-00230502
Category: Growth Factors & Cytokines
Research Area: Cardiovascular
INQUIRY
10 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Form | Lyophilized |
| Applications | HPLC; SDS-PAGE; Functional Studies |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Active: Yes; Suitable for: HPLC, SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | P10145 |
|---|---|
| Molecular Weight | 9 kDa |
| Sequence | AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFN GNEVCLDPKEKWVQKVVQIFLKKAEKQDP |
| Sequence Similarities | Belongs to the intercrine alpha (chemokine CxC) family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Function | IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively. |
| Post-translational Modifications | Several N-terminal processed forms are produced by proteolytic cleavage after secretion from at least peripheral blood monocytes, leukcocytes and endothelial cells. In general, IL-8(1-77) is referred to as interleukin-8. IL-8(6-77) is the most promiment form. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle. pH: 7.40Lyophilized from a 0.2 um filtered concentrated solution in 2 × PBS. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
