Recombinant Human Axin 2 Protein (RMPP-00230495)
Cat. No.: RMPP-00230495
Category: Kinases
Research Area: Signal Transduction
INQUIRY
20 μg
50 μg
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 0.100 Eu/µg |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Liquid |
| Applications | HPLC; SDS-PAGE |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Endotoxin level: < 0.100 Eu/µg; Tags: His tag N-Terminus; Suitable for: HPLC, SDS-PAGE |
Protein Information
| UniProt ID | P78368 |
|---|---|
| Molecular Weight | 48 kDa including tags |
| Sequence | MGSSHHHHHHSSGLVPRGSHMSKAGGGRSSHGIRSSGTSSGVLMVGPNFR VGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLS ATEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAI QLITRMEYVHTKSLIYRDVKPENFLVGRPGTKRQHAIHIIDFGLAKEYID PETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLR GSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRL DFFEKPDYDYLRKLFTDLFDRSGFVFDYEYDWAGKPLPTPIGTVHTDLPS QPQLRDKTQPHSKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADET KCCCFFKRRKRKSLQRHK |
| Sequence Similarities | Belongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family. Casein kinase I subfamily. Contains 1 protein kinase domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Cytoplasm. |
| Tissue Specificity | Testis. |
| Function | Serine/threonine-protein kinase. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling (By similarity). Phosphorylates COL4A3BP/CERT, MTA1 and SMAD3. Involved in brain development and vesicular trafficking and neurotransmitter releasing from small synaptic vesicles. Regulates fast synaptic transmission mediated by glutamate. SMAD3 phosphorylation promotes its ligand-dependent ubiquitination and subsequent proteasome degradation, thus inhibiting SMAD3-mediated TGF-beta responses. Hyperphosphorylation of the serine-repeat motif of COL4A3BP/CERT leads to its inactivation by dissociation from the Golgi complex, thus down-regulating ER-to-Golgi transport of ceramide and sphingomyelin synthesis. |
| Post-translational Modifications | Autophosphorylated. |
Storage & Shipping
| Shipping and Storage | Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 8.00Constituents: 0.32% Tris HCl, 2.9% Sodium chloride, 0.02% DTT, 10% Glycerol (glycerin, glycerine) |
|---|
For research use only. Not for clinical use.
