Recombinant Human Biglycan Protein (His tag) (RMPP-00231038)
Cat. No.: RMPP-00231038
Category: Recombinant Protein
Research Area: Neuroscience
INQUIRY
50 μg
200 μg
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | WB; SDS-PAGE; ELISA |
| Key Features | Expression system: Wheat germ; Suitable for: WB, SDS-PAGE, ELISA |
Protein Information
| UniProt ID | P52952 |
|---|---|
| Molecular Weight | 61 kDa including tags |
| Sequence | MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAA FKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDP DPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQV YELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQ TLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGY NAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDL NAVQSPGIPQSNSGVSTLHGIRAW |
| Sequence Similarities | Belongs to the NK-2 homeobox family. Contains 1 homeobox DNA-binding domain. |
| Protein Length | Full length protein |
| Cellular Localization | Nucleus. |
| Tissue Specificity | Expressed only in the heart. |
| Function | Implicated in commitment to and/or differentiation of the myocardial lineage. Acts as a transcriptional activator of ANF in cooperation with GATA4 (By similarity). It is transcriptionally controlled by PBX1 and acts as a transcriptional repressor of CDKN2B (By similarity). It is required for spleen development. |
| Involvement in Disease | Atrial septal defect 7, with or without atrioventricular conduction defectsTetralogy of FallotConotruncal heart malformationsHypothyroidism, congenital, non-goitrous, 5Ventricular septal defect 3Hypoplastic left heart syndrome 2Asplenia, isolated congenital |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
