Recombinant Human CCL4/MIP-1 beta Protein (Active) (RMPP-00230791)
Cat. No.: RMPP-00230791
Category: Recombinant Protein
Research Area: Neuroscience
INQUIRY
10 μg
1 mg
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE; Functional Studies; MS |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Active: Yes; Tags: His tag N-Terminus; Suitable for: SDS-PAGE, Functional Studies, MS |
Protein Information
| UniProt ID | P09104 |
|---|---|
| Molecular Weight | 50 kDa including tags |
| Sequence | MGSSHHHHHHSSGLVPRGSHMGSMSIEKIWAREILDSRGNPTVEVDLYTA KGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHINSRIAPAL ISSGISVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERD LPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAES FRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSEALELV KEAIDKAGYTEKMVIGMDVAASEFYRDGKYDLDFKSPADPSRYITGDQLG ALYQDFVRNYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKR IERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHRSGETE DTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHN FRNPSVL |
| Sequence Similarities | Belongs to the enolase family. |
| Protein Length | Full length protein |
| Cellular Localization | Cytoplasm. Cell membrane. Can translocate to the plasma membrane in either the homodimeric (alpha/alpha) or heterodimeric (alpha/gamma) form. |
| Tissue Specificity | The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons. |
| Developmental Stage | During ontogenesis, there is a transition from the alpha/alpha homodimer to the alpha/beta heterodimer in striated muscle cells, and to the alpha/gamma heterodimer in nerve cells. |
| Function | Has neurotrophic and neuroprotective properties on a broad spectrum of central nervous system (CNS) neurons. Binds, in a calcium-dependent manner, to cultured neocortical neurons and promotes cell survival. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: 10% Glycerol (glycerin, glycerine), PBS This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
