Banner

Recombinant Human CD14 Protein (RMPP-00230787)

Cat. No.: RMPP-00230787

Category: Growth Factors & Cytokines

Research Area: Immunology

INQUIRY 100 μg Customer Size

Product Features

Source HEK 293 cells
Purity ≥ 95% SDS-PAGE. Purity by HPLC ≥95%.
Nature Recombinant
Endotoxin Level < 0.005 Eu/µg
Carrier Free Yes
Animal Free Yes
Form Lyophilized
Applications SDS-PAGE; HPLC; MS; Cell Culture
Key Features Expression system: HEK 293 cells; Purity: ≥ 95% SDS-PAGE; Endotoxin level: < 0.005 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, Functional Studies, HPLC, MS, Cell Culture

Protein Information

UniProt ID P08700
Molecular Weight 15 kDa
Molecular Weight Information M + 2.61 Da (Calc mass 15138.39 Da).

APMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Sequence APMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILME NNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIK DGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Sequence Similarities Belongs to the IL-3 family.
Protein Length Full length protein
Cellular Localization Secreted.
Tissue Specificity Activated T-cells, mast cells, natural killer cells.
Function Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.

Storage & Shipping

Shipping and Storage Shipped at Room Temperature. Store at Room Temperature.
pH: 6.00Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% TrehaloseBuffer lyophilized from.
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.