Recombinant Human CD36 Protein (RMPP-00230781)
Cat. No.: RMPP-00230781
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
100 μg
50 μg
Product Features
| Source | E.coli |
|---|---|
| Purity | > 97% SDS-PAGE. > 97% by HPLC. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | SDS-PAGE; HPLC |
| Key Features | Expression system: E.coli; Purity: > 97% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, Functional Studies, HPLC |
Protein Information
| UniProt ID | P80075 |
|---|---|
| Molecular Weight | 9 kDa |
| Sequence | GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLC VDPTQKWVSEYMEILDQKSQILQP |
| Sequence Similarities | Belongs to the intercrine beta (chemokine CC) family. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted. |
| Tissue Specificity | Highest expression found in the small intestine and peripheral blood cells. Intermediate levels seen in the heart, placenta, lung, skeletal muscle, thymus, colon, ovary, spinal cord and pancreas. Low levels seen in the brain, liver, spleen and prostate. |
| Function | Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chemotactic activity, but inhibits the chemotactic effect most predominantly of CCL7, and also of CCL2 and CCL5 and CCL8. |
| Post-translational Modifications | N-terminal processed form MCP-2(6-76) is produced by proteolytic cleavage after secretion from peripheral blood monocytes. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
