Recombinant Human CD45 Protein (RMPP-00230778)
Cat. No.: RMPP-00230778
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
20 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 96% SDS-PAGE. > 96% by HPLC analysis. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | SDS-PAGE; HPLC |
| Key Features | Expression system: E.coli; Purity: > 96% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, Functional Studies, HPLC |
Protein Information
| UniProt ID | P10147 |
|---|---|
| Molecular Weight | 8 kDa |
| Sequence | ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQV CADPSEEWVQKYVSDLELSA |
| Sequence Similarities | Belongs to the intercrine beta (chemokine CC) family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Function | Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). |
| Post-translational Modifications | N-terminal processed form LD78-alpha(4-69) is produced by proteolytic cleavage after secretion from HTLV1-transformed T-cells. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle. pH: 7.40Constituents: 0.58% Sodium chloride, 99% Phosphate BufferLyophilised from a 0.2mm filtered concentrated solution. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
