Recombinant Human CD62L Protein (Fc Chimera) (RMPP-00230774)
Cat. No.: RMPP-00230774
Category: Recombinant Protein
Research Area: Cardiovascular
INQUIRY
10 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 98% SDS-PAGE. > 98% by HPLC analysis. |
| Nature | Recombinant |
| Animal Free | No |
| Form | Lyophilized |
| Applications | SDS-PAGE; HPLC |
| Key Features | Expression system: E.coli; Purity: > 98% SDS-PAGE; Active: Yes; Suitable for: SDS-PAGE, Functional Studies, HPLC |
Protein Information
| UniProt ID | P04085 |
|---|---|
| Molecular Weight | 25 kDa |
| Sequence | MSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNT SSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLN PDHREEETDVR |
| Sequence Similarities | Belongs to the PDGF/VEGF growth factor family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Domain | The long form contains a basic insert which acts as a cell retention signal. |
| Function | Platelet-derived growth factor is a potent mitogen for cells of mesenchymal origin. Binding of this growth factor to its receptor elicits a variety of cellular responses. It is released by platelets upon wounding and plays an important role in stimulating adjacent cells to grow and thereby heals the wound. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle. Constituent: 0.1% Trifluoroacetic acidLyophilised from a 0.2 µm filtered concentrated solution containing 30 % Acetonitrile. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
