Recombinant Human CD80 Protein (His tag) (RMPP-00230768)
Cat. No.: RMPP-00230768
Category: Recombinant Protein
Research Area: Cell Biology
INQUIRY
20 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | Fc tag C-Terminus |
| Form | Lyophilized |
| Applications | SDS-PAGE; Functional Studies; ELISA; Flow Cytometry |
| Key Features | Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: Fc tag C-Terminus; Suitable for: SDS-PAGE, Functional Studies, ELISA, Flow Cyt |
Protein Information
| UniProt ID | Q07011 |
|---|---|
| Molecular Weight | 43 kDa including tags |
| Sequence | LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFR TRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFG TFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVT PPAPAREPGHSPQ |
| Sequence Similarities | Contains 4 TNFR-Cys repeats. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Tissue Specificity | Expressed on the surface of activated T-cells. |
| Function | Receptor for TNFSF14/4-1BBL. Possibly active during T cell activation. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.4Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, L-Arginine, Sodium chloride This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
