Recombinant Human CD98 Protein (His tag) (RMPP-00230765)
Cat. No.: RMPP-00230765
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
100 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | StrepII tag C-Terminus |
| Form | Lyophilized |
| Applications | SDS-PAGE; Functional Studies; ELISA |
| Key Features | Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: StrepII tag C-Terminus; Suitable for: SDS-PAGE, Functional Studies, ELISA |
Protein Information
| UniProt ID | O94907 |
|---|---|
| Molecular Weight | 29 kDa including tags |
| Sequence | TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQ PYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGN YCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHT KGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGL EIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH |
| Sequence Similarities | Belongs to the dickkopf family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Tissue Specificity | Placenta. |
| Domain | The C-terminal cysteine-rich domain mediates interaction with LRP5 and LRP6. |
| Function | Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: PBS, 5% Trehalose This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
