Recombinant Human EPO Protein (RMPP-00230837)
Cat. No.: RMPP-00230837
Category: Growth Factors & Cytokines
Research Area: Signal Transduction
INQUIRY
50 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | ≥ 95% HPLC. ≥ 95% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | ≤ 0.005 Eu/µg |
| Carrier Free | Yes |
| Animal Free | Yes |
| Form | Lyophilized |
| Applications | SDS-PAGE; HPLC; MS; Functional Studies; Cell Culture |
| Key Features | Expression system: HEK 293 cells; Purity: ≥ 95% HPLC; Endotoxin level: ≤ 0.005 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, HPLC, MS, Functional Studies, Cell Culture |
Protein Information
| UniProt ID | O95750 |
|---|---|
| Molecular Weight | 21 kDa |
| Molecular Weight Information | Mass determination by ESI-TOF. Predicted MW is 21486.46 Da (+/- 10 Da by ESI-TOF). Observed MW is 21357.53 |
| Sequence | LAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQ SAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEE EIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPE EPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK |
| Sequence Similarities | Belongs to the heparin-binding growth factors family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Tissue Specificity | Expressed in fetal brain, cartilage, retina, and adult gall bladder. |
| Function | Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB. |
Storage & Shipping
| Shipping and Storage | Shipped at Room Temperature. Store at Room Temperature. pH: 7.4Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
