Recombinant Human FGF10 Protein (Active) (RMPP-00230631)
Cat. No.: RMPP-00230631
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
5 μg
1 mg
Product Features
| Source | Wheat germ |
|---|---|
| Purity | > 80%. Glutathione Sepharose 4 Fast Flow |
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE; WB |
| Key Features | Expression system: Wheat germ; Purity: > 80% n/a; Tags: GST tag N-Terminus; Suitable for: SDS-PAGE, ELISA, WB |
Protein Information
| UniProt ID | P11836 |
|---|---|
| Molecular Weight | 58 kDa including tags |
| Sequence | MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESK TLGAVQIMNGLFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSL LAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKME SLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF AFFQELVIAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLT ETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP |
| Sequence Similarities | Belongs to the MS4A family. |
| Protein Length | Full length protein |
| Cellular Localization | Membrane. |
| Tissue Specificity | Expressed on B-cells. |
| Function | This protein may be involved in the regulation of B-cell activation and proliferation. |
| Involvement in Disease | Defects in MS4A1 are the cause of immunodeficiency common variable type 5 (CVID5); also called antibody deficiency due to CD20 defect. CVID5 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B cells is usually in the normal range, but can be low. |
| Post-translational Modifications | Phosphorylated. Might be functionally regulated by protein kinase(s). |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
