Recombinant Human FGF18 Protein (Animal Free) (RMPP-00230747)
Cat. No.: RMPP-00230747
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
5 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Nature | Recombinant |
| Endotoxin Level | < 0.050 Eu/µg |
| Animal Free | Yes |
| Form | Lyophilized |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: E.coli; Purity: = 95% SDS-PAGE; Endotoxin level: < 0.050 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | P09603 |
|---|---|
| Molecular Weight | 36 kDa |
| Sequence | MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYL KKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNE ACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRD VVTKP |
| Protein Length | Protein fragment |
| Cellular Localization | Cell membrane and Secreted > extracellular space. |
| Function | Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. CSF-1 induces cells of the monocyte/macrophage lineage. It plays a role in immunological defenses, bone metabolism, lipoproteins clearance, fertility and pregnancy. |
| Post-translational Modifications | Glycosylation and proteolytic cleavage yield different soluble forms. A high molecular weight soluble form is a proteoglycan containing chondroitin sulfate.Isoform 1 is N- and O-glycosylated. Isoform 3 is N-glycosylated. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle. Constituent: 0.16% Sodium phosphate This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
