Recombinant Human HIC5 Protein (RMPP-00230328)
Cat. No.: RMPP-00230328
Category: Recombinant Protein
Research Area: Epigenetics and Nuclear Signaling
INQUIRY
2 μg
Customer Size
Product Features
| Source | Baculovirus infected Sf9 cells |
|---|---|
| Purity | > 90% SDS-PAGE. Affinity purified. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | Functional Studies; SDS-PAGE |
| Key Features | Expression system: Baculovirus infected Sf9 cells; Purity: > 90% SDS-PAGE; Active: Yes; Tags: GST tag N-Terminus; Suitable for: Functional Studies, SDS-PAGE |
Protein Information
| UniProt ID | Q9UQL6 |
|---|---|
| Molecular Weight Information | SDS-PAGE molecular weight: 80kDa |
| Sequence | KKLFADAQQLQPLQVYQAPLSLATVPHQALGRTQSSPAAPGSMKSPTDQP TVVKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQETGLL GKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQK MYAMLPCGGIGVDSDTVWNEMHSSSAVRMAVGCLVELAFKVAAGELKNGF AIIRPPGHHAEESTAMGFCFFNSVAITAKLLQQKLSVGKVLIVDWDIHHG NGTQQAFYNDPSVLYISLHRYDNGNFFPGSGAPEEVGGGPGVGYNVNVAW TGGVDPPIGDVEYLTAFRTVVMPIAQEFSPDVVLVSAGFDAVEGHLSPLG GYSVTARCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVSALLS VELQPLDEAVLQQKPSVNAVATLEKVIEIQSKHWSCVQRFAAGLGCSLRE AQTGEKEEAETVSAMALLSVGAEQAQAVATQEHSPRPAEEPMEQEPAL |
| Sequence Similarities | Belongs to the histone deacetylase family. HD type 2 subfamily. |
| Protein Length | Protein fragment |
| Cellular Localization | Nucleus. Cytoplasm. Shuttles between the nucleus and the cytoplasm. In muscle cells, it shuttles into the cytoplasm during myocyte differentiation. The export to cytoplasm depends on the interaction with a 14-3-3 chaperone protein and is due to its phosphorylation at Ser-259 and Ser-498 by CaMK. |
| Tissue Specificity | Ubiquitous. |
| Domain | The nuclear export sequence mediates the shuttling between the nucleus and the cytoplasm. |
| Function | Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation by repressing transcription of myocyte enhancer MEF2C. During muscle differentiation, it shuttles into the cytoplasm, allowing the expression of myocyte enhancer factors. |
| Post-translational Modifications | Phosphorylated by CaMK at Ser-259 and Ser-498. The phosphorylation is required for the export to the cytoplasm. Phosphorylated by the PKC kinases PKN1 and PKN2, impairing nuclear import.Ubiquitinated. Polyubiquitination however does not lead to its degradation. |
Storage & Shipping
| Shipping and Storage | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. pH: 7.50Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol (glycerin, glycerine) This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.