Banner

Recombinant Human HIC5 Protein (RMPP-00230328)

Cat. No.: RMPP-00230328

Category: Recombinant Protein

Research Area: Epigenetics and Nuclear Signaling

INQUIRY 2 μg Customer Size

Product Features

Source Baculovirus infected Sf9 cells
Purity > 90% SDS-PAGE. Affinity purified.
Nature Recombinant
Animal Free No
Tags GST tag N-Terminus
Form Liquid
Applications Functional Studies; SDS-PAGE
Key Features Expression system: Baculovirus infected Sf9 cells; Purity: > 90% SDS-PAGE; Active: Yes; Tags: GST tag N-Terminus; Suitable for: Functional Studies, SDS-PAGE

Protein Information

UniProt ID Q9UQL6
Molecular Weight Information SDS-PAGE molecular weight: 80kDa
Sequence KKLFADAQQLQPLQVYQAPLSLATVPHQALGRTQSSPAAPGSMKSPTDQP TVVKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQETGLL GKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQK MYAMLPCGGIGVDSDTVWNEMHSSSAVRMAVGCLVELAFKVAAGELKNGF AIIRPPGHHAEESTAMGFCFFNSVAITAKLLQQKLSVGKVLIVDWDIHHG NGTQQAFYNDPSVLYISLHRYDNGNFFPGSGAPEEVGGGPGVGYNVNVAW TGGVDPPIGDVEYLTAFRTVVMPIAQEFSPDVVLVSAGFDAVEGHLSPLG GYSVTARCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVSALLS VELQPLDEAVLQQKPSVNAVATLEKVIEIQSKHWSCVQRFAAGLGCSLRE AQTGEKEEAETVSAMALLSVGAEQAQAVATQEHSPRPAEEPMEQEPAL
Sequence Similarities Belongs to the histone deacetylase family. HD type 2 subfamily.
Protein Length Protein fragment
Cellular Localization Nucleus. Cytoplasm. Shuttles between the nucleus and the cytoplasm. In muscle cells, it shuttles into the cytoplasm during myocyte differentiation. The export to cytoplasm depends on the interaction with a 14-3-3 chaperone protein and is due to its phosphorylation at Ser-259 and Ser-498 by CaMK.
Tissue Specificity Ubiquitous.
Domain The nuclear export sequence mediates the shuttling between the nucleus and the cytoplasm.
Function Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation by repressing transcription of myocyte enhancer MEF2C. During muscle differentiation, it shuttles into the cytoplasm, allowing the expression of myocyte enhancer factors.
Post-translational Modifications Phosphorylated by CaMK at Ser-259 and Ser-498. The phosphorylation is required for the export to the cytoplasm. Phosphorylated by the PKC kinases PKN1 and PKN2, impairing nuclear import.Ubiquitinated. Polyubiquitination however does not lead to its degradation.

Storage & Shipping

Shipping and Storage Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.50Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol (glycerin, glycerine)
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.