Recombinant Human IL-2 Protein (Active) (RMPP-00230576)
Cat. No.: RMPP-00230576
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
10 μg
1 mg
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | His tag C-Terminus |
| Form | Lyophilized |
| Applications | SDS-PAGE |
| Key Features | Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Tags: His tag C-Terminus; Suitable for: SDS-PAGE |
Protein Information
| UniProt ID | P07766 |
|---|---|
| Molecular Weight | 38 kDa including tags |
| Sequence | QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGD RLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMD |
| Sequence Similarities | Contains 1 Ig-like (immunoglobulin-like) domain. Contains 1 ITAM domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Function | The CD3 complex mediates signal transduction. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle. pH: 7.4Constituents: 0.61% Tris, 0.75% Glycine, 5% TrehaloseLyophilized from 0.22 µm filtered solution. 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5% |
|---|
For research use only. Not for clinical use.