Recombinant Human IL1R1 Protein (Active) (RMPP-00230569)
Cat. No.: RMPP-00230569
Category: Growth Factors & Cytokines
Research Area: Immunology
INQUIRY
100 μg
50 μg
Product Features
| Source | Baculovirus infected insect cells |
|---|---|
| Purity | > 90% SDS-PAGE. Affinity purified |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | His tag C-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE |
| Key Features | Expression system: Baculovirus infected insect cells; Purity: > 90% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: His tag C-Terminus; Suitable for: SDS-PAGE |
Protein Information
| UniProt ID | P32970 |
|---|---|
| Molecular Weight | 18 kDa including tags |
| Sequence | ADPQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSF LHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSP ASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETF FGVQWVRPHHHHHH |
| Sequence Similarities | Belongs to the tumor necrosis factor family. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Function | Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: 10% Glycerol (glycerin, glycerine), PBS This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
