Recombinant Human Integrin beta 1 Protein (RMPP-00230375)
Cat. No.: RMPP-00230375
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
2 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | His tag C-Terminus |
| Form | Lyophilized |
| Applications | Functional Studies; SDS-PAGE |
| Key Features | Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: His tag C-Terminus; Suitable for: Functional Studies, SDS-PAGE |
Protein Information
| UniProt ID | P15260 |
|---|---|
| Molecular Weight | 27 kDa including tags |
| Sequence | EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYG VKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSE EFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTC YIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSA EGVLHVWGVTTEKSKEVCITIFNSSIKG |
| Sequence Similarities | Belongs to the type II cytokine receptor family. Contains 2 fibronectin type-III domains. Contains 2 Ig-like C2-type (immunoglobulin-like) domains. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Function | Receptor for interferon gamma. Two receptors bind one interferon gamma dimer. |
| Involvement in Disease | Defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease (MSMD); also known as familial disseminated atypical mycobacterial infection. This rare condition confers predisposition to illness caused by moderately virulent mycobacterial species, such as Bacillus Calmette-Guerin (BCG) vaccine and environmental non-tuberculous mycobacteria, and by the more virulent Mycobacterium tuberculosis. Other microorganisms rarely cause severe clinical disease in individuals with susceptibility to mycobacterial infections, with the exception of Salmonella which infects less than 50% of these individuals. The pathogenic mechanism underlying MSMD is the impairment of interferon-gamma mediated immunity whose severity determines the clinical outcome. Some patients die of overwhelming mycobacterial disease with lepromatous-like lesions in early childhood, whereas others develop, later in life, disseminated but curable infections with tuberculoid granulomas. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance. |
| Post-translational Modifications | Phosphorylated at Ser/Thr residues. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: 95% PBS, 5% TrehaloseLyophilized from 0.22 µm filtered solution. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
