Banner

Recombinant Human Integrin beta 1 Protein

Recombinant Human Integrin beta 1 Protein (RMPP-00230375)

Cat. No.: RMPP-00230375

Category: Recombinant Protein

Research Area: Immunology

INQUIRY 2 μg Customer Size

Product Features

Source HEK 293 cells
Purity > 95% SDS-PAGE.
Nature Recombinant
Endotoxin Level < 1.000 Eu/µg
Animal Free No
Tags His tag C-Terminus
Form Lyophilized
Applications Functional Studies; SDS-PAGE
Key Features Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: His tag C-Terminus; Suitable for: Functional Studies, SDS-PAGE

Protein Information

UniProt ID P15260
Molecular Weight 27 kDa including tags
Sequence EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYG VKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSE EFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTC YIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSA EGVLHVWGVTTEKSKEVCITIFNSSIKG
Sequence Similarities Belongs to the type II cytokine receptor family. Contains 2 fibronectin type-III domains. Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
Protein Length Protein fragment
Cellular Localization Membrane.
Function Receptor for interferon gamma. Two receptors bind one interferon gamma dimer.
Involvement in Disease Defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease (MSMD); also known as familial disseminated atypical mycobacterial infection. This rare condition confers predisposition to illness caused by moderately virulent mycobacterial species, such as Bacillus Calmette-Guerin (BCG) vaccine and environmental non-tuberculous mycobacteria, and by the more virulent Mycobacterium tuberculosis. Other microorganisms rarely cause severe clinical disease in individuals with susceptibility to mycobacterial infections, with the exception of Salmonella which infects less than 50% of these individuals. The pathogenic mechanism underlying MSMD is the impairment of interferon-gamma mediated immunity whose severity determines the clinical outcome. Some patients die of overwhelming mycobacterial disease with lepromatous-like lesions in early childhood, whereas others develop, later in life, disseminated but curable infections with tuberculoid granulomas. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance.
Post-translational Modifications Phosphorylated at Ser/Thr residues.

Storage & Shipping

Shipping and Storage Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.40Constituents: 95% PBS, 5% TrehaloseLyophilized from 0.22 µm filtered solution.
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.