Recombinant Human ITGB1BP3 Protein (RMPP-00230878)
Cat. No.: RMPP-00230878
Category: Growth Factors & Cytokines
Research Area: Signal Transduction
INQUIRY
20 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | ≥ 95% HPLC. |
| Nature | Recombinant |
| Endotoxin Level | ≤ 0.005 Eu/µg |
| Carrier Free | Yes |
| Animal Free | No |
| Form | Lyophilized |
| Applications | SDS-PAGE; HPLC; Cell Culture; Biological Activity |
| Key Features | Expression system: HEK 293 cells; Purity: ≥ 95% HPLC; Endotoxin level: ≤ 0.005 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, MS, HPLC, Cell Culture, Biological Activity |
Protein Information
| UniProt ID | P01344 |
|---|---|
| Molecular Weight | 20 kDa |
| Sequence | AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRS CDLALLETYCATPAKSE |
| Sequence Similarities | Belongs to the insulin family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Function | The insulin-like growth factors possess growth-promoting activity. In vitro, they are potent mitogens for cultured cells. IGF-II is influenced by placental lactogen and may play a role in fetal development.Preptin undergoes glucose-mediated co-secretion with insulin, and acts as physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3. |
| Involvement in Disease | Epigenetic changes of DNA hypomethylation in IGF2 are a cause of Silver-Russell syndrome (SIRS). SIRS is a clinically heterogeneous condition characterized by severe intrauterine growth retardation, poor postnatal growth, craniofacial features such as a triangular shaped face and a broad forehead, body asymmetry, and a variety of minor malformations. |
| Post-translational Modifications | O-glycosylated with a core 1 or possibly core 8 glycan. |
Storage & Shipping
| Shipping and Storage | Shipped at Room Temperature. Store at Room Temperature. pH: 7.4Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
