Recombinant Human MCP2 Protein (Active) (RMPP-00230872)
Cat. No.: RMPP-00230872
Category: Recombinant Protein
Research Area: Signal Transduction
INQUIRY
10 μg
1 mg
Product Features
| Source | E.coli |
|---|---|
| Purity | > 85% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE; MS |
| Key Features | Expression system: E.coli; Purity: > 85% SDS-PAGE; Tags: His tag N-Terminus; Suitable for: SDS-PAGE, MS |
Protein Information
| UniProt ID | O76061 |
|---|---|
| Molecular Weight | 33 kDa including tags |
| Sequence | TDATNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENN SCEIRGLHGICMTFLHNAGKFDAQGKSFIKDALKCKAHALRHRFGCISRK CPAIREMVSQLQRECYLKHDLCAAAQENTRVIVEMIHFKDLLLHEPYVDL VNLLLTCGEEVKEAITHSVQVQCEQNWGSLCSILSFCTSAIQKPPTAPPE RQPQVDRTKLSRAHHGEAGHHLPEPSSRETGRGAKGERGSKSHPNAHARG RVGGLGAQGPSGSSEWEDEQSEYSDIRR |
| Sequence Similarities | Belongs to the stanniocalcin family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Tissue Specificity | Expressed in a variety of tissues including muscle, heart, pancreas, kidney, spleen, prostate, small intestine, colon and peripheral blood leukocytes. |
| Function | Has an anti-hypocalcemic action on calcium and phosphate homeostasis. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 8.00Constituents: 0.02% DTT, 0.32% Tris HCl, 30% Glycerol (glycerin, glycerine), 1.46% Sodium chloride |
|---|
For research use only. Not for clinical use.
