Recombinant Human NIP7 Protein (RMPP-00230868)
Cat. No.: RMPP-00230868
Category: Recombinant Protein
Research Area: Signal Transduction
INQUIRY
100 μg
500 μg
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE; MS |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Tags: His tag N-Terminus; Suitable for: SDS-PAGE, MS |
Protein Information
| UniProt ID | O14907 |
|---|---|
| Molecular Weight | 16 kDa including tags |
| Sequence | MGSSHHHHHHSSGLVPRGSHMSYIPGQPVTAVVQRVEIHKLRQGENLILG FSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQV NGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS |
| Sequence Similarities | Contains 1 PDZ (DHR) domain. |
| Protein Length | Full length protein |
| Cellular Localization | Cytoplasm. Nucleus. |
| Tissue Specificity | Detected in various cell lines including HeLa. Weakly expressed in peripheral blood leukocytes. |
| Function | May play a role in the Rho signaling pathway. May act as an inhibitor of the Wnt signaling pathway. May play a role in activation of CDC42 by the viral protein HPV16 E6. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 8.00Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride |
|---|
For research use only. Not for clinical use.
