Recombinant Human SFRP4 Protein (Active) (RMPP-00230827)
Cat. No.: RMPP-00230827
Category: Growth Factors & Cytokines
Research Area: Cardiovascular
INQUIRY
25 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | ≥ 95% HPLC. |
| Nature | Recombinant |
| Endotoxin Level | ≤ 0.005 Eu/µg |
| Carrier Free | Yes |
| Animal Free | No |
| Form | Lyophilized |
| Applications | SDS-PAGE; HPLC; MS; Cell Culture; Biological Activity |
| Key Features | Expression system: HEK 293 cells; Purity: ≥ 95% HPLC; Endotoxin level: ≤ 0.005 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, HPLC, MS, Cell Culture, Biological Activity |
Protein Information
| UniProt ID | P01135 |
|---|---|
| Molecular Weight | 17 kDa |
| Sequence | ENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVC HSGYVGARCEHADLLAVVAASQKKQ |
| Sequence Similarities | Contains 1 EGF-like domain. |
| Protein Length | Full length protein |
| Cellular Localization | Cell membrane and Secreted > extracellular space. |
| Tissue Specificity | Isoform 1, isoform 3 and isoform 4 are expressed in keratinocytes and tumor-derived cell lines. |
| Function | TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar. |
Storage & Shipping
| Shipping and Storage | Shipped at Room Temperature. Store at Room Temperature. pH: 7.4Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
