Recombinant Human Sonic Hedgehog Protein (Active) (RMPP-00230925)
Cat. No.: RMPP-00230925
Category: Recombinant Protein
Research Area: Tags & Cell Markers
INQUIRY
100 μg
1 mg
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | SDS-PAGE; WB; ELISA |
| Key Features | Expression system: Wheat germ; Suitable for: SDS-PAGE, WB, ELISA |
Protein Information
| UniProt ID | P13473 |
|---|---|
| Molecular Weight | 36 kDa including tags |
| Sequence | ELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSIC GDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFP |
| Sequence Similarities | Belongs to the LAMP family. |
| Protein Length | Protein fragment |
| Cellular Localization | Cell membrane. Endosome membrane. Lysosome membrane. This protein shuttles between lysosomes, endosomes, and the plasma membrane. |
| Tissue Specificity | Isoform LAMP-2A is highly expressed in placenta, lung and liver, less in kidney and pancreas, low in brain and skeletal muscle. Isoform LAMP-2B is highly expressed in skeletal muscle, less in brain, placenta, lung, kidney and pancreas, very low in liver. |
| Function | Implicated in tumor cell metastasis. May function in protection of the lysosomal membrane from autodigestion, maintenance of the acidic environment of the lysosome, adhesion when expressed on the cell surface (plasma membrane), and inter-and intracellular signal transduction. Protects cells from the toxic effects of methylating mutagens. |
| Involvement in Disease | Defects in LAMP2 are the cause of Danon disease (DAND); also known as glycogen storage disease type 2B (GSD2B). DAND is a lysosomal glycogen storage disease characterized by the clinical triad of cardiomyopathy, vacuolar myopathy and mental retardation. It is often associated with an accumulation of glycogen in muscle and lysosomes. |
| Post-translational Modifications | O- and N-glycosylated; some of the 16 N-linked glycans are polylactosaminoglycans. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.3% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
