Recombinant Human STAT3 Protein (RMPP-00230845)
Cat. No.: RMPP-00230845
Category: Recombinant Protein
Research Area: Stem Cells
INQUIRY
50 μg
20 μg
Product Features
| Source | E.coli |
|---|---|
| Purity | > 90% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Liquid |
| Applications | SDS-PAGE; MS |
| Key Features | Expression system: E.coli; Purity: > 90% SDS-PAGE; Tags: His tag N-Terminus; Suitable for: SDS-PAGE, MS |
Protein Information
| UniProt ID | O43323 |
|---|---|
| Molecular Weight | 22 kDa including tags |
| Sequence | MGSSHHHHHHSSGLVPRGSHMGSMIIGPGRGPVGRRRYARKQLVPLLYKQ FVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADR LMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRAL DITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAG G |
| Sequence Similarities | Belongs to the hedgehog family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted > extracellular space. The C-terminal peptide diffuses from the cell and Cell membrane. The N-terminal peptide remains associated with the cell surface. |
| Function | Intercellular signal essential for a variety of patterning events during development. May function as a spermatocyte survival factor in the testes. Essential for testes development. |
| Involvement in Disease | Defects in DHH may be the cause of partial gonadal dysgenesis with minifascicular neuropathy 46,XY (PGD). PGD is characterized by the presence of a testis on one side and a streak or an absent gonad at the other, persistence of Muellerian duct structures, and a variable degree of genital ambiguity.Defects in DHH may be the cause of complete pure gonadal dysgenesis 46,XY type (GDXYM); also known as male-limited gonadal dysgenesis 46,XY. GDXYM is a type of hypogonadism in which no functional gonads are present to induce puberty in an externally female person whose karyotype is then found to be XY. The gonads are found to be non-functional streaks. |
| Post-translational Modifications | The C-terminal domain displays an autoproteolysis activity and a cholesterol transferase activity. Both activities result in the cleavage of the full-length protein and covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-terminal fragment (N-product). This covalent modification appears to play an essential role in restricting the spatial distribution of the protein activity to the cell surface. The N-product is the active species in both local and long-range signaling, whereas the C-product has no signaling activity. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.50Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol (glycerin, glycerine), 0.88% Sodium chloride |
|---|
For research use only. Not for clinical use.
