Recombinant Human STYX Protein (26-223aa) (RMPP-00230921)
Cat. No.: RMPP-00230921
Category: Recombinant Protein
Research Area: Epigenetics and Nuclear Signaling
INQUIRY
10 μg
Customer Size
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | SDS-PAGE; WB; ELISA |
| Key Features | Expression system: Wheat germ; Suitable for: SDS-PAGE, WB, ELISA |
Protein Information
| UniProt ID | P11831 |
|---|---|
| Molecular Weight | 37 kDa including tags |
| Sequence | HMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVP QVFLTASSGTVQIPVSAVQLHQMAVIGQQAGSSSNLTELQVVNLDTAHST KSE |
| Sequence Similarities | Contains 1 MADS-box domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Nucleus. |
| Function | SRF is a transcription factor that binds to the serum response element (SRE), a short sequence of dyad symmetry located 300 bp to the 5' of the site of transcription initiation of some genes (such as FOS). Required for cardiac differentiation and maturation. |
| Post-translational Modifications | Phosphorylated by PRKDC. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.3% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
