Recombinant Human STYX Protein (RMPP-00230924)
Cat. No.: RMPP-00230924
Category: Recombinant Protein
Research Area: Neuroscience
INQUIRY
50 μg
Customer Size
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | SDS-PAGE; WB; ELISA |
| Key Features | Expression system: Wheat germ; Suitable for: SDS-PAGE, WB, ELISA |
Protein Information
| UniProt ID | P46531 |
|---|---|
| Molecular Weight | 38 kDa including tags |
| Sequence | RCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDPNPCLSTPCKNAG TCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTL TEYKCRCPPG |
| Sequence Similarities | Belongs to the NOTCH family. Contains 5 ANK repeats. Contains 36 EGF-like domains. Contains 3 LNR (Lin/Notch) repeats. |
| Protein Length | Protein fragment |
| Cellular Localization | Cell membrane and Nucleus. Following proteolytical processing NICD is translocated to the nucleus. |
| Tissue Specificity | In fetal tissues mostthis product in spleen, brain stem and lung. Also present in most adult tissues where it is found mainly in lymphoid tissues. |
| Function | Functions as a receptor for membrane-bound ligands Jagged1, Jagged2 and Delta1 to regulate cell-fate determination. Upon ligand activation through the released notch intracellular domain (NICD) it forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes of the enhancer of split locus. Affects the implementation of differentiation, proliferation and apoptotic programs. May be important for normal lymphocyte function. In altered form, may contribute to transformation or progression in some T-cell neoplasms. Involved in the maturation of both CD4+ and CD8+ cells in the thymus. May be important for follicular differentiation and possibly cell fate selection within the follicle. During cerebellar development, may function as a receptor for neuronal DNER and may be involved in the differentiation of Bergmann glia. |
| Involvement in Disease | Defects in NOTCH1 are a cause of bicuspid aortic valve (BAV). A common defect in the aortic valve in which two rather than three leaflets are present. It is often associated with aortic valve calcification and insufficiency. In extreme cases, the blood flow may be so restricted that the left ventricle fails to grow, resulting in hypoplastic left heart syndrome. |
| Post-translational Modifications | Synthesized in the endoplasmic reticulum as an inactive form which is proteolytically cleaved by a furin-like convertase in the trans-Golgi network before it reaches the plasma membrane to yield an active, ligand-accessible form. Cleavage results in a C-terminal fragment N(TM) and a N-terminal fragment N(EC). Following ligand binding, it is cleaved by TNF-alpha converting enzyme (TACE) to yield a membrane-associated intermediate fragment called notch extracellular truncation (NEXT). This fragment is then cleaved by presenilin dependent gamma-secretase to release a notch-derived peptide containing the intracellular domain (NICD) from the membrane.Phosphorylated.O-glycosylated on the EGF-like domains. Contains both O-linked fucose and O-linked glucose.Ubiquitinated; undergoes 'Lys-29'-linked polyubiquitination catalyzed by ITCH. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.3% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.