Recombinant Human Tropomyosin 3 + PDGFR beta fusion Protein (Active) (RMPP-00230693)
Cat. No.: RMPP-00230693
Category: Growth Factors & Cytokines
Research Area: Signal Transduction
INQUIRY
5 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | 95% SDS-PAGE. Determined by reducing and non-reducing SDS-PAGE, UV spectroscopy at 280 nm. |
| Nature | Recombinant |
| Endotoxin Level | < 0.050 Eu/µg |
| Animal Free | Yes |
| Form | Lyophilized |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: E.coli; Endotoxin level: < 0.050 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | P41159 |
|---|---|
| Molecular Weight | 16 kDa |
| Sequence | MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPIL TLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLP WASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |
| Sequence Similarities | Belongs to the leptin family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Function | May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass. |
| Involvement in Disease | Defects in LEP may be a cause of obesity (OBESITY). It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle. Constituent: 0.1% Trifluoroacetic acidLyophilized from a sterile filtered solution. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
