Recombinant Mouse ApolipoProtein E (His tag) (RMPP-00231053)
Cat. No.: RMPP-00231053
Category: Growth Factors & Cytokines
Research Area: Immunology
INQUIRY
100 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | ≥ 95% HPLC. |
| Nature | Recombinant |
| Endotoxin Level | ≤ 0.005 Eu/µg |
| Animal Free | Yes |
| Form | Lyophilized |
| Key Features | Expression system: HEK 293 cells; Purity: ≥ 95% HPLC; Endotoxin level: ≤ 0.005 Eu/µg; Active: Yes |
Protein Information
| UniProt ID | P14778 |
|---|---|
| Sequence | DKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQ ASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNL CYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLD NIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEE NKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDED DPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGI DAAYIQLIYPVT |
| Sequence Similarities | Belongs to the interleukin-1 receptor family. Contains 3 Ig-like C2-type (immunoglobulin-like) domains. Contains 1 TIR domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Function | Receptor for interleukin-1 alpha (IL-1A), beta (IL-1B), and interleukin-1 receptor antagonist protein (IL-1RA). Binding to the agonist leads to the activation of NF-kappa-B. Signaling involves formation of a ternary complex containing IL1RAP, TOLLIP, MYD88, and IRAK1 or IRAK2. |
Storage & Shipping
| Shipping and Storage | Shipped at Room Temperature. Store at Room Temperature. pH: 7.4Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
