Recombinant Mouse CD38 Protein (Tagged)

Products

Online Inquiry

Recombinant Mouse CD38 Protein (Tagged) (RMPP-00230288)

Cat. No.: RMPP-00230288

Category: Growth Factors & Cytokines

Research Area: Immunology

INQUIRY 100 μg Customer Size

Product Features

Source	HEK 293 cells
Purity	> 95% SDS-PAGE. Purified by ion exchnage chromatography.
Nature	Recombinant
Endotoxin Level	< 1.000 Eu/µg
Animal Free	No
Form	Lyophilized
Applications	Functional Studies; SDS-PAGE
Key Features	Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Suitable for: Functional Studies, SDS-PAGE

Protein Information

UniProt ID	P09919
Molecular Weight	19 kDa
Sequence	TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLL GHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELG PTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGG VLVASHLQSFLEVSYRVLRHLAQP
Sequence Similarities	Belongs to the IL-6 superfamily.
Protein Length	Protein fragment
Cellular Localization	Secreted.
Function	Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes.
Post-translational Modifications	O-glycan consists of Gal-GalNAc disaccharide which can be modified with up to two sialic acid residues (done in recombinantly expressed G-CSF from CHO cells).

Storage & Shipping

Shipping and Storage	Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: 90% PBS, 10% TrehaloseLyophilized from 0.22 µm filtered solution. 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5% This product is an active protein and may elicit a biological response in vivo, handle with caution.

Shipping and Storage

Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40Constituents: 90% PBS, 10% TrehaloseLyophilized from 0.22 µm filtered solution.
5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.