Recombinant Mouse GM-CSF Protein (Active) (RMPP-00230379)
Cat. No.: RMPP-00230379
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
20 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | Functional Studies; SDS-PAGE |
| Key Features | Expression system: E.coli; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Suitable for: Functional Studies, SDS-PAGE |
Protein Information
| UniProt ID | P78423 |
|---|---|
| Molecular Weight | 9 kDa including tags |
| Sequence | QHLGMTKCEIMCGKMTSRIPVALLIRYQLNQESCGKRAIVLETTQHRRFC ADPKEKWVQDAMKHLDHQAAALTKNG |
| Sequence Similarities | Belongs to the intercrine delta family. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted and Cell membrane. |
| Tissue Specificity | Small intestine, colon, testis, prostate, heart, brain, lung, skeletal muscle, kidney and pancreas. |
| Function | The soluble form is chemotactic for T-cells and monocytes, but not for neutrophils. The membrane-bound form promotes adhesion of those leukocytes to endothelial cells. May play a role in regulating leukocyte adhesion and migration processes at the endothelium. Binds to CX3CR1. |
| Post-translational Modifications | A soluble short 95 kDa form may be released by proteolytic cleavage from the long membrane-anchored form.O-glycosylated with core 1 or possibly core 8 glycans. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Constituent: PBS0.2 µm filtered This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
