Recombinant Mouse IL-3 Protein (Animal Free) (RMPP-00230967)
Cat. No.: RMPP-00230967
Category: Recombinant Protein
Research Area: Cell Biology
INQUIRY
10 μg
1 mg
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | > 0.100 Eu/µg |
| Animal Free | No |
| Tags | DDDDK tag N-Terminus |
| Form | Lyophilized |
| Applications | WB; ELISA; Functional Studies; SDS-PAGE |
| Key Features | Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Endotoxin level: > 0.100 Eu/µg; Active: Yes; Tags: DDDDK tag N-Terminus; Suitable for: WB, ELISA, Functional Studies, SDS-PAGE |
Protein Information
| UniProt ID | P48023 |
|---|---|
| Molecular Weight | 32 kDa including tags |
| Sequence | QIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKG GLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKM MSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLY KL |
| Sequence Similarities | Belongs to the tumor necrosis factor family. |
| Protein Length | Full length protein |
| Cellular Localization | Cell membrane. Secreted. May be released into the extracellular fluid, probably by cleavage form the cell surface. |
| Function | Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. May be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. Binding to the decoy receptor TNFRSF6B/DcR3 modulates its effects. |
| Involvement in Disease | Defects in FASLG are the cause of autoimmune lymphoproliferative syndrome type 1B (ALPS1B); also known as Canale-Smith syndrome (CSS). ALPS is a childhood syndrome involving hemolytic anemia and thrombocytopenia with massive lymphadenopathy and splenomegaly. |
| Post-translational Modifications | N-glycosylated.The soluble form derives from the membrane form by proteolytic processing. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. Constituent: 99% PBS This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
