Recombinant Mouse IL-6 Protein (Active) (RMPP-00230659)
Cat. No.: RMPP-00230659
Category: Recombinant Protein
Research Area: Signal Transduction
INQUIRY
10 μg
1 mg
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 95% SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | His tag C-Terminus |
| Form | Lyophilized |
| Applications | SDS-PAGE; Functional Studies |
| Key Features | Expression system: HEK 293 cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: His tag C-Terminus; Suitable for: SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | P07585 |
|---|---|
| Molecular Weight | 39 kDa including tags |
| Sequence | GPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQ CSDLGLDKVPKDLPPDTTLLDLQN NKITEIKDGDFKNLKNLHALILVN NKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITK VRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITS IPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGS LANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCP PGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK |
| Sequence Similarities | Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class I subfamily. Contains 12 LRR (leucine-rich) repeats. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted > extracellular space > extracellular matrix. |
| Function | May affect the rate of fibrils formation. |
| Involvement in Disease | Defects in DCN are the cause of congenital stromal corneal dystrophy (CSCD). Corneal dystrophies are inherited, bilateral, primary alterations of the cornea that are not associated with prior inflammation or secondary to systemic disease. Most show autosomal dominant inheritance. |
| Post-translational Modifications | The attached glycosaminoglycan chain can be either chondroitin sulfate or dermatan sulfate depending upon the tissue of origin. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: 94% PBS, 5% Trehalose This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
