Recombinant Mouse LXN/TCI Protein (RMPP-00230965)
Cat. No.: RMPP-00230965
Category: Recombinant Protein
Research Area: Signal Transduction
INQUIRY
100 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 90% SDS-PAGE. Please filter the product by an appropriate sterile filter before using it in cell culture. |
| Nature | Recombinant |
| Endotoxin Level | < 0.100 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | WB; ELISA |
| Key Features | Expression system: HEK 293 cells; Purity: > 90% SDS-PAGE; Endotoxin level: < 0.100 Eu/µg; Suitable for: WB, ELISA |
Protein Information
| UniProt ID | O76061 |
|---|---|
| Molecular Weight | 33 kDa |
| Sequence | TDATNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENN SCEIRGLHGICMTFLHNAGKFDAQGKSFIKDALKCKAHALRHRFGCISRK CPAIREMVSQLQRECYLKHDLCAAAQENTRVIVEMIHFKDLLLHEPYVDL VNLLLTCGEEVKEAITHSVQVQCEQNWGSLCSILSFCTSAIQKPPTAPPE RQPQVDRTKLSRAHHGEAGHHLPEPSSRETGRGAKGERGSKSHPNAHARG RVGGLGAQGPSGSSEWEDEQSEYSDIRRAAADYKDDDDK |
| Sequence Similarities | Belongs to the stanniocalcin family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Tissue Specificity | Expressed in a variety of tissues including muscle, heart, pancreas, kidney, spleen, prostate, small intestine, colon and peripheral blood leukocytes. |
| Function | Has an anti-hypocalcemic action on calcium and phosphate homeostasis. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. Constituents: 0.242% Tris, 0.116% Sodium chloride |
|---|
For research use only. Not for clinical use.
