Recombinant Mouse MCP1 Protein (RMPP-00230986)
Cat. No.: RMPP-00230986
Category: Recombinant Protein
Research Area: Stem Cells
INQUIRY
10 μg
2 μg
Product Features
| Source | E.coli |
|---|---|
| Purity | > 90% SDS-PAGE. Purified by 6xHis-GST tags / Immobilized-metal affinity chromatography (IMAC). |
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | WB; ELISA; SDS-PAGE; MS |
| Key Features | Expression system: E.coli; Purity: > 90% SDS-PAGE; Suitable for: WB, ELISA, SDS-PAGE, MS |
Protein Information
| UniProt ID | Q01628 |
|---|---|
| Molecular Weight | 43 kDa including tags |
| Sequence | MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRS ETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYA STAKCLNIWALILGILMTILLIVIPVLIFQAYG |
| Sequence Similarities | Belongs to the CD225 family. |
| Protein Length | Full length protein |
| Cellular Localization | Cell membrane. |
| Function | IFN-induced antiviral protein that mediates cellular innate immunity to at least three major human pathogens, namely influenza A H1N1 virus, West Nile virus (WNV), and dengue virus (WNV), by inhibiting the early step(s) of replication. |
| Post-translational Modifications | Palmitoylation on membrane-proximal cysteines controls clustering in membrane compartments and antiviral activity against influenza virus. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 7.40Constituents: PBS, 30% Glycerol |
|---|
For research use only. Not for clinical use.
