Recombinant Mouse Sonic Hedgehog Protein (RMPP-00230956)
Cat. No.: RMPP-00230956
Category: Recombinant Protein
Research Area: Epigenetics and Nuclear Signaling
INQUIRY
5 μg
1 mg
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | WB; ELISA |
| Key Features | Expression system: Wheat germ; Tags: GST tag N-Terminus; Suitable for: WB, ELISA |
Protein Information
| UniProt ID | P60323 |
|---|---|
| Sequence | MGTFDLWTDYLGLAHLVRALSGKEGPETRLSPQPEPEPMLEPVSALEPMP APESVPVPGPKDQKRSLESSPAPERLCSFCKHNGESRAIYQSHVLKDEAG |
| Sequence Similarities | Belongs to the nanos family. Contains 1 nanos-type zinc finger. |
| Protein Length | Protein fragment |
| Cellular Localization | Nucleus. Cytoplasm. Cytoplasmic granule. Cytoplasm > P-body. The cytoplasmic granules are stress granules which are a dense aggregation in the cytosol composed of proteins and RNAs that appear when the cell is under stress. Co-localizes with PUM2, EIF2S1 and TIAL1 in the stress granules. Co-localizes with DCP1A in the P-body. |
| Tissue Specificity | Ovary, testis and brain (at protein level). In the ovaries, expressed during multiple stages of oogenesis, including primordial, primary, secondary and antral follicles with the highest expression in the oocytes. In the testis, expressed in germ cells, type A spermatogonia (SA), primary spermatocytes (S1), round spermatids (S3) and elongated spermatids. |
| Developmental Stage | Fetal ovary and fetal testis (at protein level). |
| Domain | The Nanos-type zinc finger is composed of two C2HC motifs, each motif binding one molecule of zinc. It is essential for the translation repression activity of the protein. |
| Function | Plays a role in the maintenance of the undifferentiated state of germ cells regulating the spermatogonia cell cycle and inducing a prolonged transit in G1 phase. Affects cell proliferation probably by repressing translation of specific mRNAs. Maintains the germ cell lineage by suppressing both Bax-dependent and -independent apoptotic pathways. Essential in the early stage embryo to protect the migrating primordial germ cells (PGCs) from apoptosis. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
