Banner

Recombinant Mouse VEGF Receptor 2 Protein (Fc Chimera Active)

Recombinant Mouse VEGF Receptor 2 Protein (Fc Chimera Active) (RMPP-00230284)

Cat. No.: RMPP-00230284

Category: Recombinant Protein

Research Area: Epigenetics and Nuclear Signaling

INQUIRY 100 μg Customer Size

Product Features

Source Baculovirus infected Sf9 cells
Purity > 70% SDS-PAGE. Affinity purified.
Nature Recombinant
Animal Free No
Tags GST tag C-Terminus
Form Liquid
Applications Functional Studies; SDS-PAGE
Key Features Expression system: Baculovirus infected Sf9 cells; Purity: > 70% SDS-PAGE; Active: Yes; Tags: GST tag C-Terminus; Suitable for: Functional Studies, SDS-PAGE

Protein Information

UniProt ID P56524
Molecular Weight Information SDS-PAGE molecular weight: ~155kDa
Sequence SRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQ KLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPR YWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFPLRKTASEPNL KLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGP SSPNNSSGSVSAENGIAPAVPSIPAETSLAHRLVAREGSAAPLPLYTSPS LPNITLGLPATGPSAGTAGQQDAERLTLPALQQRLSLFPGTHLTPYLSTS PLERDGGAAHSPLLQHMVLLEQPPAQAPLVTGLGALPLHAQSLVGADRVS PSIHKLRQHRPLGRTQSAPLPQNAQALQHLVIQQQHQQFLEKHKQQFQQQ QLQMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPYLDRLPGQKEA HAQAGVQVKQEPIESDEEEAEPPREVEPGQRQPSEQELLFRQQALLLEQQ RIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPVSVQEPPTKP RFTTGLVYDTLMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCEC IRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLASVFVRLP CGGVGVDSDTIWNEVHSAGAARLAVGCVVELVFKVATGELKNGFAVVRPP GHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKILIVDWDVHHGNGTQQA FYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDP PMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSA RCFGYLTKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPL PEKVLQQRPNANAVRSMEKVMEIHSKYWRCLQRTTSTAGRSLIEAQTCEN EEAETVTAMASLSVGVKPAEKRPDEEPMEEEPPL
Sequence Similarities Belongs to the histone deacetylase family. HD type 2 subfamily.
Protein Length Protein fragment
Cellular Localization Nucleus. Cytoplasm. Shuttles between the nucleus and the cytoplasm. Upon muscle cells differentiation, it accumulates in the nuclei of myotubes, suggesting a positive role of nuclear HDAC4 in muscle differentiation. The export to cytoplasm depends on the interaction with a 14-3-3 chaperone protein and is due to its phosphorylation at Ser-246, Ser-467 and Ser-632 by CaMK4. The nuclear localization probably depends on sumoylation.
Tissue Specificity Ubiquitous.
Domain The nuclear export sequence mediates the shuttling between the nucleus and the cytoplasm.
Function Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation via its interaction with the myocyte enhancer factors such as MEF2A, MEF2C and MEF2D.
Involvement in Disease Defects in HDAC4 are the cause of brachydactyly-mental retardation syndrome (BDMR). A syndrome resembling the physical anomalies found in Albright hereditary osteodystrophy. Common features are mild facial dysmorphism, congenital heart defects, distinct brachydactyly type E, mental retardation, developmental delay, seizures, autism spectrum disorder, and stocky build. Soft tissue ossification is absent, and there are no abnormalities in parathyroid hormone or calcium metabolism.
Post-translational Modifications Phosphorylated by CaMK4 at Ser-246, Ser-467 and Ser-632. Phosphorylation at other residues is required for the interaction with 14-3-3.Sumoylation on Lys-559 is promoted by the E3 SUMO-protein ligase RANBP2, and prevented by phosphorylation by CaMK4.

Storage & Shipping

Shipping and Storage Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.50Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol (glycerin, glycerine)
This product is an active protein and may elicit a biological response in vivo, handle with caution.

For research use only. Not for clinical use.