Recombinant rat FGF2 Protein (Animal Free) (RMPP-00230944)
Cat. No.: RMPP-00230944
Category: Growth Factors & Cytokines
Research Area: Signal Transduction
INQUIRY
50 μg
1 mg
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | WB; ELISA |
| Key Features | Expression system: Wheat germ; Tags: GST tag N-Terminus; Suitable for: WB, ELISA |
Protein Information
| UniProt ID | P01233 |
|---|---|
| Sequence | GYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVA LSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLP GPSDTPILPQ |
| Sequence Similarities | Belongs to the glycoprotein hormones subunit beta family. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted. |
| Tissue Specificity | Placenta. |
| Developmental Stage | Made by the first trimester placenta. |
| Function | Stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
