Recombinant rat IGF1 Protein (RMPP-00230535)
Cat. No.: RMPP-00230535
Category: Growth Factors & Cytokines
Research Area: Immunology
INQUIRY
50 μg
1 mg
Product Features
| Source | Insect cells |
|---|---|
| Purity | > 95% SDS-PAGE. Affinity purified |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | His tag C-Terminus |
| Form | Liquid |
| Applications | MS; SDS-PAGE |
| Key Features | Expression system: Insect cells; Purity: > 95% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: His tag C-Terminus; Suitable for: MS, SDS-PAGE |
Protein Information
| UniProt ID | P05231 |
|---|---|
| Molecular Weight | 23 kDa including tags |
| Sequence | FPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNS DCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYL EYMKNNLKDNKKDKARVLQRDTETLIHIFNQEVKDLHKIVLPTPISNALL TDKLESQKEWLRTKTIQFILKSLEEFLKVTLRSTRQTHHHHHH |
| Sequence Similarities | Belongs to the IL-6 superfamily. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Function | Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. |
| Involvement in Disease | Genetic variations in IL6 are associated with susceptibility to rheumatoid arthritis systemic juvenile (RASJ). An inflammatory articular disorder with systemic-onset beginning before the age of 16. It represents a subgroup of juvenile arthritis associated with severe extraarticular features and occasionally fatal complications. During active phases of the disorder, patients display a typical daily spiking fever, an evanescent macular rash, lymphadenopathy, hepatosplenomegaly, serositis, myalgia and arthritis.Note=A IL6 promoter polymorphism is associated with a lifetime risk of development of Kaposi sarcoma in HIV-infected men. |
| Post-translational Modifications | N- and O-glycosylated. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. pH: 7.40Constituents: 10% Glycerol (glycerin, glycerine), 90% PBS This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
