Recombinant rat M-CSF Protein (Active) (RMPP-00230940)
Cat. No.: RMPP-00230940
Category: Recombinant Protein
Research Area: Cardiovascular
INQUIRY
100 μg
1 mg
Product Features
| Source | E.coli |
|---|---|
| Purity | > 75% SDS-PAGE. |
| Nature | Recombinant |
| Animal Free | No |
| Tags | His tag N-Terminus |
| Form | Lyophilized |
| Applications | WB |
| Key Features | Expression system: E.coli; Purity: > 75% SDS-PAGE; Tags: His tag N-Terminus; Suitable for: WB |
Protein Information
| UniProt ID | P06858 |
|---|---|
| Molecular Weight | 52 kDa including tags |
| Sequence | MKHHHHHHASADQRRDFIDIESKFALRTPEDTAEDTCHLIPGVAESVATC HFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRA QEHYPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGI AGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSP GRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAERGLGDVDQLVKCS HERSIHLFIDSLLNEENPSKAYRCSSKEAFEKGLCLSCRKNRCNNLGYEI SKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQAFEISLY GTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSW SDWWSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHD KSLNKKSG |
| Sequence Similarities | Belongs to the AB hydrolase superfamily. Lipase family. Contains 1 PLAT domain. |
| Protein Length | Full length protein |
| Cellular Localization | Cell membrane. Secreted. Locates to the plasma membrane of microvilli of hepatocytes with triacyl-glycerol-rich lipoproteins (TRL). Some of the bound LPL is then internalized and located inside non-coated endocytic vesicles. |
| Function | The primary function of this lipase is the hydrolysis of triglycerides of circulating chylomicrons and very low density lipoproteins (VLDL). Binding to heparin sulfate proteogylcans at the cell surface is vital to the function. The apolipoprotein, APOC2, acts as a coactivator of LPL activity in the presence of lipids on the luminal surface of vascular endothelium. |
| Involvement in Disease | Defects in LPL are the cause of lipoprotein lipase deficiency (LPL deficiency); also known as familial chylomicronemia or hyperlipoproteinemia type I. LPL deficiency chylomicronemia is a recessive disorder usually manifesting in childhood. On a normal diet, patients often present with abdominal pain, hepatosplenomegaly, lipemia retinalis, eruptive xanthomata, and massive hypertriglyceridemia, sometimes complicated with acute pancreatitis. |
| Post-translational Modifications | Tyrosine nitration after lipopolysaccharide (LPS) challenge down-regulates the lipase activity. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -80°C. Constituents: 0.3% Acetic acid, 0.4% Sodium acetate |
|---|
For research use only. Not for clinical use.
