Recombinant rat PCSK9 Protein (His tag) (RMPP-00230407)
Cat. No.: RMPP-00230407
Category: Recombinant Protein
Research Area: Stem Cells
INQUIRY
50 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | > 90% SDS-PAGE. 2-8% human IgG1 Fc fragment as determined by SDS-PAGE. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Tags | Fc tag C-Terminus |
| Form | Lyophilized |
| Applications | Functional Studies; SDS-PAGE; ELISA |
| Key Features | Expression system: HEK 293 cells; Purity: > 90% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Tags: Fc tag C-Terminus; Suitable for: Functional Studies, SDS-PAGE, ELISA |
Protein Information
| UniProt ID | P51654 |
|---|---|
| Molecular Weight | 87 kDa |
| Molecular Weight Information | This protein contains a furin-like convertase cleavage site, 354-RQYR-357, and will be partially processed into N and C-terminal fragment with Calculated MW of 38.0 kDa and 49.1 kDa respectively. |
| Sequence | QPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGPTCCSR KMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVRHAKNY TNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLF PVIYTQMMNPGLPESVLDINECLRGARRDLKVFGSFPKLIMTQVSKSLQV TRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCG GYCNVVMQGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFS TIHDSIQYVQKNGGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKILKV AHVEHEETLSSRRRELIQKLKSFINFYSALPGYICSHSPVAENDTLCWNG QELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRT MSVPKGKVLDKSLDEEGLESGDCGDDEDECIGSSGDGMVKVKNQLRFLAE LAYDLDVDDAPGNKQHGNQKDNEITTSHSVGNM |
| Sequence Similarities | Belongs to the glypican family. |
| Protein Length | Protein fragment |
| Cellular Localization | Cell membrane and Secreted > extracellular space. |
| Tissue Specificity | Highly expressed in lung, liver and kidney. |
| Function | Cell surface proteoglycan that bears heparan sulfate. Inhibits the dipeptidyl peptidase activity of DPP4. May be involved in the suppression/modulation of growth in the predominantly mesodermal tissues and organs. May play a role in the modulation of IGF2 interactions with its receptor and thereby modulate its function. May regulate growth and tumor predisposition. |
| Involvement in Disease | Defects in GPC3 are the cause of Simpson-Golabi-Behmel syndrome type 1 (SGBS1); also known as Simpson dysmorphia syndrome (SDYS). SGBS is a condition characterized by pre- and postnatal overgrowth (gigantism) with visceral and skeletal anomalies. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section. pH: 7.4Constituents: 0.61% Tris, Glycine, 5% Trehalose, L-Arginine, Sodium chlorideLyophilized from 0.22 µm filtered solution. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
