Anti-CD22 Antibody (RMAB-0250253)
Cat. No.: RMAB-0250253
Category: Primary Antibodies
INQUIRY
100 μL
Customer Size
Mouse monoclonal to CD22
Product Features
Isotype | IgG1 |
---|---|
Clonality | Monoclonal |
Host Species | Mouse |
Clone Number | 2H1C4 |
Form | Liquid |
Purity | Protein G purified |
Species Reactivity | Human, Mouse |
Immunogen | Recombinant fragment corresponding to Human CD22 aa 621-725. expressed in E. Coli.Sequence: NPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRS PLSTLTVYYSPETIGRRVAVGLGSCLAILILAICGLKLQRRWKRTQSQQG LQENS |
Applications | ICC/IF, Flow Cyt, IHC-P, WB |
Key Features | Mouse monoclonal to CD22; Suitable for: ICC/IF, Flow Cyt, IHC-P, WB; Reacts with: Mouse, Human; Isotype: IgG1 |
Target Information
Target Symbol | CD22 |
---|---|
Target Name | B-cell receptor CD22 |
UniProt ID | P20273 |
Cellular Localization | Cell membrane. |
Function | Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules. |
Post-translational Modifications | Phosphorylation of Tyr-762, Tyr-87 and Tyr-822 are involved in binding to SYK, GRB2 and SYK, respectively. Phosphorylation of Tyr-842 is involved in binding to SYK, PLCG2 and PIK3R1/PIK3R2. Phosphorylated on tyrosine residues by LYN. |
Domain | Contains 4 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. |
Sequence Similarities | Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family. Contains 6 Ig-like C2-type (immunoglobulin-like) domains. Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
Storage & Shipping
Storage Buffer | Preservative: 0.05% Sodium azide; Constituent: 99% PBS |
---|---|
Storage & Shipping | Shipped at 4°C. Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. |
For research use only. Not for clinical use.