Banner

Anti-Syndecan-1 Antibody (RMAB-0251126)

Cat. No.: RMAB-0251126

Category: Primary Antibodies

INQUIRY 100 μg Customer Size
Mouse monoclonal to Syndecan-1

Product Features

Isotype IgG1
Clonality Monoclonal
Host Species Mouse
Clone Number 1A3H4
Form Liquid
Purity Protein G purified
Species Reactivity Human, Mouse
Immunogen Recombinant fragment corresponding to Human Syndecan-1 aa 28-171 (internal sequence). Expressed in E. Coli.Sequence: NLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQTPSTWKDTQLLTAIPTS PEPTGLEATA
ASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQEATPRP RETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPS
Applications IHC-P, WB, ICC/IF, Flow Cyt
Key Features Mouse monoclonal to Syndecan-1; Suitable for: IHC-P, WB, ICC/IF, Flow Cyt; Reacts with: Mouse, Human; Isotype: IgG1

Target Information

Target Symbol SDC1
Target Name Syndecan-1
UniProt ID P18827
Cellular Localization Membrane.
Function Cell surface proteoglycan that bears both heparan sulfate and chondroitin sulfate and that links the cytoskeleton to the interstitial matrix.
Sequence Similarities Belongs to the syndecan proteoglycan family.

Storage & Shipping

Storage Buffer Preservative: 0.05% Sodium azide; Constituent: 99% PBS
Storage & Shipping Shipped at 4°C. Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

For research use only. Not for clinical use.