DDX4 / MVH Peptide (RMPP-00231041)
Cat. No.: RMPP-00231041
Category: Recombinant Protein
Research Area: Epigenetics and Nuclear Signaling
INQUIRY
1mg
Customer Size
Product Features
| Source | Wheat germ |
|---|---|
| Nature | Recombinant |
| Animal Free | No |
| Form | Liquid |
| Applications | WB; SDS-PAGE; ELISA |
| Key Features | Expression system: Wheat germ; Suitable for: WB, SDS-PAGE, ELISA |
Protein Information
| UniProt ID | P17481 |
|---|---|
| Molecular Weight | 37 kDa including tags |
| Sequence | GESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLS TAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAA |
| Sequence Similarities | Belongs to the Antp homeobox family. Contains 1 homeobox DNA-binding domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Nucleus. |
| Developmental Stage | Expressed in whole embryos and fetuses at 5-9 weeks from conception. |
| Function | Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
