Native Human CD13 Protein (RMPP-00230819)
Cat. No.: RMPP-00230819
Category: Recombinant Protein
Research Area: Neuroscience
INQUIRY
50 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | ≥ 95% HPLC. SDS-PAGE ≥ 95% |
| Nature | Recombinant |
| Endotoxin Level | ≤ 0.005 Eu/µg |
| Carrier Free | Yes |
| Animal Free | Yes |
| Tags | Fc tag C-Terminus |
| Form | Lyophilized |
| Applications | SDS-PAGE; HPLC; MS |
| Key Features | Expression system: HEK 293 cells; Purity: ≥ 95% HPLC; Endotoxin level: ≤ 0.005 Eu/µg; Active: Yes; Tags: Fc tag C-Terminus; Suitable for: SDS-PAGE, HPLC, MS |
Protein Information
| UniProt ID | P08138 |
|---|---|
| Molecular Weight | 50 kDa including tags |
| Molecular Weight Information | Predicted MW is 49499.96198 Da (+/-10 Da by ESI-TOF). Observed MW is 49373.46 Da. |
| Sequence | KEACPTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDSVTFSDVVS ATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVC EAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLR ECTRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTV AGVVTTVMGSSQPVVTRGTTDN |
| Sequence Similarities | Contains 1 death domain. Contains 4 TNFR-Cys repeats. |
| Protein Length | Full length protein |
| Cellular Localization | Membrane. |
| Domain | Death domain is responsible for interaction with RANBP9.The extracellular domain is responsible for interaction with NTRK1. |
| Function | Low affinity receptor which can bind to NGF, BDNF, NT-3, and NT-4. Can mediate cell survival as well as cell death of neural cells. |
| Post-translational Modifications | N- and O-glycosylated.O-linked glycans consist of Gal(1-3)GalNAc core elongated by 1 or 2 NeuNAc.Phosphorylated on serine residues. |
Storage & Shipping
| Shipping and Storage | Shipped at Room Temperature. Store at Room Temperature. pH: 7.40Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
