Banner

Rat MAP2 Peptide (RMPP-00231016)

Cat. No.: RMPP-00231016

Category: Recombinant Protein

Research Area: Cardiovascular

INQUIRY 100 μg Customer Size

Product Features

Source Wheat germ
Purity ≥ 80% Purified via GST Tag. Glutathione Sepharose 4 Fast Flow
Nature Recombinant
Animal Free No
Tags GST tag N-Terminus
Form Liquid
Applications WB; SDS-PAGE
Key Features Expression system: Wheat germ; Purity: ≥ 80% Purified via GST Tag; Tags: GST tag N-Terminus; Suitable for: WB, SDS-PAGE

Protein Information

UniProt ID P21926
Molecular Weight 52 kDa including tags
Sequence MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETN NNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIF AIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYAL NCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVG IGIAVVMIFGMIFSMILCCAIRRNREMV
Sequence Similarities Belongs to the tetraspanin (TM4SF) family.
Protein Length Full length protein
Cellular Localization Membrane.
Tissue Specificity Expressed by a variety of hematopoietic and epithelial cells.
Function Involved in platelet activation and aggregation. Regulates paranodal junction formation. Involved in cell adhesion, cell motility and tumor metastasis. Required for sperm-egg fusion.
Post-translational Modifications Protein exists in three forms with molecular masses between 22 and 27 kDa, and is known to carry covalently linked fatty acids.

Storage & Shipping

Shipping and Storage Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl

For research use only. Not for clinical use.