Rat MAP2 Peptide (RMPP-00231016)
Cat. No.: RMPP-00231016
Category: Recombinant Protein
Research Area: Cardiovascular
INQUIRY
100 μg
Customer Size
Product Features
| Source | Wheat germ |
|---|---|
| Purity | ≥ 80% Purified via GST Tag. Glutathione Sepharose 4 Fast Flow |
| Nature | Recombinant |
| Animal Free | No |
| Tags | GST tag N-Terminus |
| Form | Liquid |
| Applications | WB; SDS-PAGE |
| Key Features | Expression system: Wheat germ; Purity: ≥ 80% Purified via GST Tag; Tags: GST tag N-Terminus; Suitable for: WB, SDS-PAGE |
Protein Information
| UniProt ID | P21926 |
|---|---|
| Molecular Weight | 52 kDa including tags |
| Sequence | MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETN NNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIF AIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYAL NCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVG IGIAVVMIFGMIFSMILCCAIRRNREMV |
| Sequence Similarities | Belongs to the tetraspanin (TM4SF) family. |
| Protein Length | Full length protein |
| Cellular Localization | Membrane. |
| Tissue Specificity | Expressed by a variety of hematopoietic and epithelial cells. |
| Function | Involved in platelet activation and aggregation. Regulates paranodal junction formation. Involved in cell adhesion, cell motility and tumor metastasis. Required for sperm-egg fusion. |
| Post-translational Modifications | Protein exists in three forms with molecular masses between 22 and 27 kDa, and is known to carry covalently linked fatty acids. |
Storage & Shipping
| Shipping and Storage | Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. pH: 8.00Constituents: 0.31% Glutathione, 0.79% Tris HCl |
|---|
For research use only. Not for clinical use.
