Recombinant cynomolgus Monkey CD40 Protein (Active) (RMPP-00230526)
Cat. No.: RMPP-00230526
Category: Growth Factors & Cytokines
Research Area: Immunology
INQUIRY
100 μg
Customer Size
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | ≥ 95% SDS-PAGE. ≥ 95% HPLC. |
| Nature | Recombinant |
| Endotoxin Level | < 0.005 Eu/µg |
| Carrier Free | Yes |
| Animal Free | Yes |
| Form | Lyophilized |
| Applications | MS; Cell Culture; Functional Studies |
| Key Features | Expression system: HEK 293 cells; Purity: ≥ 95% SDS-PAGE; Endotoxin level: < 0.005 Eu/µg; Active: Yes; Suitable for: MS, Cell Culture, HPLC, SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | P01579 |
|---|---|
| Molecular Weight | 17 kDa |
| Sequence | QDPYVQEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIV SFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSV TDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |
| Sequence Similarities | Belongs to the type II (or gamma) interferon family. |
| Protein Length | Full length protein |
| Cellular Localization | Secreted. |
| Tissue Specificity | Released primarily from activated T lymphocytes. |
| Function | Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. |
| Involvement in Disease | In Caucasians, genetic variation in IFNG is associated with the risk of aplastic anemia (AA). AA is a rare disease in which the reduction of the circulating blood cells results from damage to the stem cell pool in bone marrow. In most patients, the stem cell lesion is caused by an autoimmune attack. T-lymphocytes, activated by an endogenous or exogenous, and most often unknown antigenic stimulus, secrete cytokines, including IFN-gamma, which would in turn be able to suppress hematopoiesis. |
| Post-translational Modifications | Proteolytic processing produces C-terminal heterogeneity, with proteins ending alternatively at Gly-150, Met-157 or Gly-161. |
Storage & Shipping
| Shipping and Storage | Shipped at Room Temperature. Store at Room Temperature. pH: 6.00Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% TrehaloseBuffer lyophilized from. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.