Recombinant Human 14-3-3 Theta + Tau Protein (RMPP-00230518)
Cat. No.: RMPP-00230518
Category: Recombinant Protein
Research Area: Immunology
INQUIRY
20 μg
50 μg
Product Features
| Source | HEK 293 cells |
|---|---|
| Purity | ≥ 95% HPLC. SDS-PAGE ≥ 95% |
| Nature | Recombinant |
| Endotoxin Level | ≤ 0.005 Eu/µg |
| Carrier Free | Yes |
| Animal Free | Yes |
| Tags | His tag C-Terminus |
| Form | Lyophilized |
| Applications | HPLC; MS |
| Key Features | Expression system: HEK 293 cells; Purity: ≥ 95% HPLC; Endotoxin level: ≤ 0.005 Eu/µg; Active: Yes; Tags: His tag C-Terminus; Suitable for: HPLC, SDS-PAGE, MS |
Protein Information
| UniProt ID | P06729 |
|---|---|
| Molecular Weight | 23 kDa including tags |
| Molecular Weight Information | Predicted MW is 22759.88 Da (+/- 10 Da by ESI-TOF). Observed MW is 22763.34 Da. |
| Sequence | KEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKE KETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDL KIQERVSKPKISWTCINTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITH KWTTSLSAKFKCTAGNKVSKESSVEPVSCPEKGLD |
| Sequence Similarities | Contains 1 Ig-like C2-type (immunoglobulin-like) domain. Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
| Protein Length | Protein fragment |
| Cellular Localization | Membrane. |
| Function | CD2 interacts with lymphocyte function-associated antigen (LFA-3) and CD48/BCM1 to mediate adhesion between T-cells and other cell types. CD2 is implicated in the triggering of T-cells, the cytoplasmic domain is implicated in the signaling function. |
Storage & Shipping
| Shipping and Storage | Shipped at Room Temperature. Store at Room Temperature. pH: 7.40Constituents: 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Monobasic dihydrogen potassium phosphate, 10.26% Trehalose This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
