Recombinant Human 14-3-3 Theta + Tau Protein (RMPP-00230807)
Cat. No.: RMPP-00230807
Category: Recombinant Protein
Research Area: Stem Cells
INQUIRY
100 μg
Customer Size
Product Features
| Source | E.coli |
|---|---|
| Purity | > 98% SDS-PAGE. >98% as determined by HPLC. |
| Nature | Recombinant |
| Endotoxin Level | < 1.000 Eu/µg |
| Animal Free | No |
| Form | Lyophilized |
| Applications | SDS-PAGE; HPLC; Functional Studies |
| Key Features | Expression system: E.coli; Purity: > 98% SDS-PAGE; Endotoxin level: < 1.000 Eu/µg; Active: Yes; Suitable for: SDS-PAGE, HPLC, Functional Studies |
Protein Information
| UniProt ID | O43323 |
|---|---|
| Molecular Weight | 20 kDa |
| Sequence | IIGPGRGPVGRRRYVRKQLVPLLYKQFVPSMPERTLGASGPAEGRVTRGS ERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGV RLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGF DWVYYESRNHIHVSVKADNSLAVRAGG |
| Sequence Similarities | Belongs to the hedgehog family. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted > extracellular space. The C-terminal peptide diffuses from the cell and Cell membrane. The N-terminal peptide remains associated with the cell surface. |
| Function | Intercellular signal essential for a variety of patterning events during development. May function as a spermatocyte survival factor in the testes. Essential for testes development. |
| Involvement in Disease | Defects in DHH may be the cause of partial gonadal dysgenesis with minifascicular neuropathy 46,XY (PGD). PGD is characterized by the presence of a testis on one side and a streak or an absent gonad at the other, persistence of Muellerian duct structures, and a variable degree of genital ambiguity.Defects in DHH may be the cause of complete pure gonadal dysgenesis 46,XY type (GDXYM); also known as male-limited gonadal dysgenesis 46,XY. GDXYM is a type of hypogonadism in which no functional gonads are present to induce puberty in an externally female person whose karyotype is then found to be XY. The gonads are found to be non-functional streaks. |
| Post-translational Modifications | The C-terminal domain displays an autoproteolysis activity and a cholesterol transferase activity. Both activities result in the cleavage of the full-length protein and covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-terminal fragment (N-product). This covalent modification appears to play an essential role in restricting the spatial distribution of the protein activity to the cell surface. The N-product is the active species in both local and long-range signaling, whereas the C-product has no signaling activity. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Constituents: 0.87% Sodium chloride, Phosphate Buffer This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.