Recombinant Human Activin Receptor Type IA (mutated Q207E) Protein (Cytoplasmic domain) (RMPP-00230508)
Cat. No.: RMPP-00230508
Category: Growth Factors & Cytokines
Research Area: Cardiovascular
INQUIRY
10 μg
5 μg
Product Features
| Source | E.coli |
|---|---|
| Purity | ≥ 98% SDS-PAGE. = 98% by HPLC. |
| Nature | Recombinant |
| Animal Free | No |
| Form | Lyophilized |
| Applications | HPLC; SDS-PAGE; Functional Studies |
| Key Features | Expression system: E.coli; Purity: ≥ 98% SDS-PAGE; Active: Yes; Suitable for: HPLC, SDS-PAGE, Functional Studies |
Protein Information
| UniProt ID | P12644 |
|---|---|
| Molecular Weight | 12 kDa |
| Sequence | KKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNST NHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVV EGCGCR |
| Sequence Similarities | Belongs to the TGF-beta family. |
| Protein Length | Protein fragment |
| Cellular Localization | Secreted > extracellular space > extracellular matrix. |
| Tissue Specificity | Expressed in the lung and lower levels seen in the kidney. Present also in normal and neoplastic prostate tissues, and prostate cancer cell lines. |
| Function | Induces cartilage and bone formation. Also act in mesoderm induction, tooth development, limb formation and fracture repair. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction. |
| Involvement in Disease | Defects in BMP4 are the cause of microphthalmia syndromic type 6 (MCOPS6); also known as microphthalmia and pituitary anomalies or microphthalmia with brain and digit developmental anomalies. Microphthalmia is a clinically heterogeneous disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues (anophthalmia). In many cases, microphthalmia/anophthalmia occurs in association with syndromes that include non-ocular abnormalities. MCOPS6 is characterized by microphthalmia/anophthalmia associated with facial, genital, skeletal, neurologic and endocrine anomalies.Defects in BMP4 are the cause of non-syndromic orofacial cleft type 11 (OFC11). Non-syndromic orofacial cleft is a common birth defect consisting of cleft lips with or without cleft palate. Cleft lips are associated with cleft palate in two-third of cases. A cleft lip can occur on one or both sides and range in severity from a simple notch in the upper lip to a complete opening in the lip extending into the floor of the nostril and involving the upper gum. OFC11 is an unusual anomaly consisting of a paramedian scar of the upper lip with an appearance suggesting that a typical cleft lip was corrected in utero. |
Storage & Shipping
| Shipping and Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Constituent: 0.19% Citric acid This product is an active protein and may elicit a biological response in vivo, handle with caution. |
|---|
For research use only. Not for clinical use.
